PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_137453g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 253aa    MW: 28699.4 Da    PI: 10.2378
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_137453g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     + +WT eEd++lv+++++ G g+W++ ++  g+ R++k+c++rw +yl
   MA_137453g0010 14 KVPWTREEDKILVNYIQKNGHGNWRALPKLAGLLRSGKSCRLRWTNYL 61
                     579*****************************99************97 PP

2Myb_DNA-binding51.32.7e-1667109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++T+eE++ ++++++ lG++ W++Ia+ ++ gRt++++k++w 
   MA_137453g0010  67 RGSFTEEEEQSIIQLHAILGNK-WSAIASQLP-GRTDNEIKNFWS 109
                      89********************.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129414.997961IPR017930Myb domain
SuperFamilySSF466891.46E-3011108IPR009057Homeodomain-like
SMARTSM007172.9E-131363IPR001005SANT/Myb domain
PfamPF002494.2E-151461IPR001005SANT/Myb domain
CDDcd001675.60E-111661No hitNo description
PROSITE profilePS5129424.662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2665116IPR009057Homeodomain-like
SMARTSM007177.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.5E-1567109IPR001005SANT/Myb domain
CDDcd001671.97E-1069108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSEGPCCKKT GLKKVPWTRE EDKILVNYIQ KNGHGNWRAL PKLAGLLRSG KSCRLRWTNY  60
LSPDIKRGSF TEEEEQSIIQ LHAILGNKWS AIASQLPGRT DNEIKNFWSS RLKKRLLRMG  120
LDPSTHAPIA EANPTSPRQS EALALLRHKA QWENARLEAE ARLSRASLLV SSNSTTGYRT  180
NNSTEDMITM RNDNPPTDYF LKLWNSEAGK AFRKESSNRR CDYSRHVFDL NHPPDKVGDD  240
QVLSSAIPKT PQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1081820.0BT108182.1 Picea glauca clone GQ03117_O07 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051856.12e-89Myb domain protein 17 isoform 1
SwissprotP800731e-59MYB2_PHYPA; Myb-related protein Pp2
TrEMBLA0A061E1593e-89A0A061E159_THECC; Myb domain protein 17 isoform 1
STRINGVIT_15s0046g03190.t013e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-76myb domain protein 17